DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and spint1b

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001104693.2 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:501 Species:Danio rerio


Alignment Length:35 Identity:16/35 - (45%)
Similarity:20/35 - (57%) Gaps:1/35 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC-NRC 87
            |.||:.|||||:..:.||..|.|.|....:| |.|
Zfish   253 WNYNAASRRCEQFIFGGCMENSNNYLSETECQNAC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/32 (44%)
spint1bNP_001104693.2 None

Return to query results.
Submit another query.