DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and TFPI

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:76 Identity:25/76 - (32%)
Similarity:38/76 - (50%) Gaps:19/76 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLCTGGRDEGNR---------NGRFCGLTAQNGM-------WFYNSRSRRCEKMNYRGCGGNGNR 77
            ::||  ||..||         ...||.|....|:       :|||:::::||:..|.||.||.|.
Human   102 KMCT--RDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNN 164

  Fly    78 YCKVEDC-NRC 87
            :..:|:| |.|
Human   165 FETLEECKNIC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/40 (33%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656 0/2 (0%)
Kunitz_TFPI1_2-like 121..176 CDD:438657 19/55 (35%)
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.