DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and SPINT1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:70 Identity:17/70 - (24%)
Similarity:27/70 - (38%) Gaps:7/70 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYC 79
            |::...:...:.....|......|...|.|       ..|:|:...:.|:...|.||.||.|.|.
Human   234 ANVTVTVLSTKQTEDYCLASNKVGRCRGSF-------PRWYYDPTEQICKSFVYGGCLGNKNNYL 291

  Fly    80 KVEDC 84
            :.|:|
Human   292 REEEC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 12/32 (38%)
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 16/59 (27%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.