powered by:
Protein Alignment CG42538 and Crisp3
DIOPT Version :9
Sequence 1: | NP_001163451.1 |
Gene: | CG42538 / 8673985 |
FlyBaseID: | FBgn0260646 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_074050.1 |
Gene: | Crisp3 / 64827 |
RGDID: | 619846 |
Length: | 246 |
Species: | Rattus norvegicus |
Alignment Length: | 61 |
Identity: | 14/61 - (22%) |
Similarity: | 21/61 - (34%) |
Gaps: | 21/61 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 YVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCE-KMNYRGCG 72
||..:.:...:|.|. ..|.|..::| .| :..|| :.||..||
Rat 178 YVGRLYSPYTEGEPC-DSCPGNCEDG-----LC--------------TNSCEYEDNYSNCG 218
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42538 | NP_001163451.1 |
KU |
<53..88 |
CDD:294074 |
6/21 (29%) |
Crisp3 | NP_074050.1 |
SCP_CRISP |
39..174 |
CDD:240183 |
|
Crisp |
192..246 |
CDD:285731 |
10/47 (21%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.