DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and col28a1a

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:48 Identity:16/48 - (33%)
Similarity:22/48 - (45%) Gaps:12/48 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGLTAQNG-------MWFYNSRSRRCEKMNYRGCGGNGNRY-----CK 80
            ||.....|       ||:|:.::..|.:..|.||.||.||:     ||
Zfish  1117 CGQGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNRFETEDICK 1164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/33 (39%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 16/48 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.