powered by:
Protein Alignment CG42538 and Ag5r
DIOPT Version :9
Sequence 1: | NP_001163451.1 |
Gene: | CG42538 / 8673985 |
FlyBaseID: | FBgn0260646 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001245671.1 |
Gene: | Ag5r / 44631 |
FlyBaseID: | FBgn0015010 |
Length: | 256 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 13/47 - (27%) |
Similarity: | 20/47 - (42%) |
Gaps: | 12/47 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 YVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMW--FYN 57
|:||:|.:.|| .:.:|..|......:.||..| :||
Fly 98 YLASLNVKSCQ----------MKHDGCHNTDAFDWSGQNLAWMGYYN 134
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42538 | NP_001163451.1 |
KU |
<53..88 |
CDD:294074 |
3/7 (43%) |
Ag5r | NP_001245671.1 |
SCP_euk |
59..211 |
CDD:240180 |
13/47 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.