powered by:
Protein Alignment CG42538 and scpr-A
DIOPT Version :9
Sequence 1: | NP_001163451.1 |
Gene: | CG42538 / 8673985 |
FlyBaseID: | FBgn0260646 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650062.1 |
Gene: | scpr-A / 41358 |
FlyBaseID: | FBgn0037889 |
Length: | 264 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 9/45 - (20%) |
Similarity: | 18/45 - (40%) |
Gaps: | 9/45 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 YVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYN 57
::|.:|.:.|:..| |:.....||......|.::.|:
Fly 98 HLALLNVKTCESLP---------DKCRSTERFAYAGQNNALFQYS 133
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42538 | NP_001163451.1 |
KU |
<53..88 |
CDD:294074 |
1/5 (20%) |
scpr-A | NP_650062.1 |
SCP_euk |
60..212 |
CDD:240180 |
9/45 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.