DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and wfikkn1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_999912.1 Gene:wfikkn1 / 406570 ZFINID:ZDB-GENE-040426-2465 Length:558 Species:Danio rerio


Alignment Length:87 Identity:30/87 - (34%)
Similarity:34/87 - (39%) Gaps:20/87 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CQGRPVFQLCTGGRDEGNRNGR-FCGLTAQNG-------MWFYNSRSRRCEKMNYRGCGGNGN-- 76
            |:||..|......|....|.|: .|.|.|..|       .|||||.:.|||...|.||.||.|  
Zfish   347 CEGRNRFHTFEECRASCQREGQAVCSLPAVQGPCRHWQARWFYNSLTERCEAFLYGGCSGNKNSF 411

  Fly    77 ---RYC-------KVEDCNRCR 88
               |.|       :...|..||
Zfish   412 GTRRECDAHCPTHRPRPCRSCR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 17/44 (39%)
wfikkn1NP_999912.1 WAP 25..72 CDD:459672
KAZAL_FS 124..160 CDD:238052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..194
Ig 193..287 CDD:472250
Ig strand B 210..214 CDD:409353
Ig strand C 223..227 CDD:409353
Ig strand E 245..249 CDD:409353
Ig strand F 267..272 CDD:409353
Ig strand G 280..283 CDD:409353
Kunitz_WFIKKN_1-like 313..363 CDD:438648 5/15 (33%)
Kunitz_WFIKKN_2-like 370..422 CDD:438649 20/51 (39%)
NTR_WFIKKN 439..547 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.