DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and ambp

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:78 Identity:22/78 - (28%)
Similarity:33/78 - (42%) Gaps:21/78 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLCTGGRDEGNRNG--------------RFCGLTAQNG-------MWFYNSRSRRCEKMNYRGCG 72
            |:.|.|...||:|.              ..|.|....|       :|.::|.|.:|..:.|.||.
Zfish   251 QMFTFGGCMGNQNNFPTEKDCLQSCRTEAACRLPMDAGPCKAFVDLWAFDSSSGKCLSLKYGGCK 315

  Fly    73 GNGNRYCKVEDCN 85
            |||||:...::|:
Zfish   316 GNGNRFYSKKECD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/33 (39%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639 6/24 (25%)
Kunitz_bikunin_2-like 278..332 CDD:438640 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.