DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and tfpia

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001296732.1 Gene:tfpia / 359833 ZFINID:ZDB-GENE-030711-1 Length:279 Species:Danio rerio


Alignment Length:84 Identity:23/84 - (27%)
Similarity:37/84 - (44%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ACLTLYVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNG-------MWFYNSRSRRCEK 65
            :|..|.:.|:.. :|..|  |:...|.|.|.....:.|.|....|       .::::..:.|||.
Zfish     8 SCKPLLLLSLFG-VCFAR--FERSDGVRSELRIFHQSCALKKDEGPCKAMKDRFYFDIDTGRCEP 69

  Fly    66 MNYRGCGGNGNRYCKVEDC 84
            ..|.||.||.|.:..::||
Zfish    70 FEYGGCQGNANNFETLQDC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 11/32 (34%)
tfpiaNP_001296732.1 Kunitz_TFPI1_1-like 39..93 CDD:438656 14/50 (28%)
Kunitz-type 101..151 CDD:438633
Kunitz-type 202..255 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.