DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG13748

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:62 Identity:17/62 - (27%)
Similarity:28/62 - (45%) Gaps:13/62 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DEGNRNGR------FCGLTAQNGM-------WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            |:....||      ||.:.|:.|:       |.|:...::|.:..:.||.||.|.:...:||
  Fly    45 DDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDC 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 10/39 (26%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 14/50 (28%)

Return to query results.
Submit another query.