DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG10031

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster


Alignment Length:40 Identity:14/40 - (35%)
Similarity:22/40 - (55%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            |.::.:.  ::||..|:.||...|.||.||.||:...:.|
  Fly    84 CRMSLER--FYYNKDSKACETFKYGGCRGNDNRWGFRQTC 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/32 (41%)
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 14/40 (35%)

Return to query results.
Submit another query.