DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG16713

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:91 Identity:28/91 - (30%)
Similarity:40/91 - (43%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLIMACLTLYVA---SINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRR 62
            ||.|:::.....:||   ::...|| |.|         ...|.:||. ...|....|.|::....
  Fly     1 MKLLILVFVFVAFVANALALKNAIC-GLP---------HSLNGDGRI-SCEAYIPSWSYDADRNE 54

  Fly    63 CEKMNYRGCGGNGNRYCKVEDC-NRC 87
            |.|..|.|||||.||:...|.| ::|
  Fly    55 CVKFIYGGCGGNNNRFNSREICEDKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/33 (42%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/66 (33%)

Return to query results.
Submit another query.