DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG31609

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:52 Identity:19/52 - (36%)
Similarity:24/52 - (46%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGLTAQNG-------MWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC-NRCR 88
            |...|..|       :|.|:..:.||....|.|||||.||:...|:| ..||
  Fly    31 CWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCR 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/33 (42%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 17/49 (35%)

Return to query results.
Submit another query.