DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Col28a1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:31 Identity:10/31 - (32%)
Similarity:19/31 - (61%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            |:|:.:...|.:..:.||.|:|||:...::|
  Rat  1104 WYYDKQVNSCARFWFSGCNGSGNRFHSEKEC 1134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 10/31 (32%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.