DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Spint1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:83 Identity:22/83 - (26%)
Similarity:28/83 - (33%) Gaps:25/83 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTGGRDEGN-----------------RNGRFCGLTAQNGM-------WFYNSRSRRCEKMNYRGC 71
            |..|.||..                 .:..:|......|.       |:||..|.||.:..|.||
  Rat   338 CPDGSDEATCEKYSSGFDELQSIHFLSDKGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGC 402

  Fly    72 GGNGNRYCKVEDC-NRCR 88
            .||.|.:.|.:.| ..||
  Rat   403 YGNKNNFEKEQQCLESCR 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/40 (35%)
Spint1NP_001004265.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666
LDLa 313..344 CDD:197566 2/5 (40%)
Kunitz_HAI1_2-like 369..428 CDD:438667 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.