DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and K11D12.11

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_504352.2 Gene:K11D12.11 / 260212 WormBaseID:WBGene00019650 Length:195 Species:Caenorhabditis elegans


Alignment Length:53 Identity:14/53 - (26%)
Similarity:23/53 - (43%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGLTAQNGM----------WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDCNRC 87
            |.|:..:|:          ::.::.:..|....|.|||||.|.:.....|.||
 Worm    26 CQLSLHHGVQKCTNTSSLRFYMDADTETCLAFKYSGCGGNSNNFDTWGKCMRC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 9/42 (21%)
K11D12.11NP_504352.2 KU 24..77 CDD:197529 12/50 (24%)

Return to query results.
Submit another query.