DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and AMBP

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:52 Identity:20/52 - (38%)
Similarity:27/52 - (51%) Gaps:4/52 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC-NRCR 88
            |...|...|:|::   :|||..|..||...|.||.||||.:...::| ..||
Human   234 GYSAGPCMGMTSR---YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/33 (42%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639 18/50 (36%)
Kunitz_bikunin_2-like 284..338 CDD:438640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.