DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Tfpi2

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001368837.1 Gene:Tfpi2 / 21789 MGIID:108543 Length:266 Species:Mus musculus


Alignment Length:69 Identity:24/69 - (34%)
Similarity:38/69 - (55%) Gaps:12/69 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ICQGR---PVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVE 82
            :|:.|   |.|  |:..:|||     .|  :|....:::|||::.||...|.|||||.|.:..::
Mouse   181 LCEPRKHIPSF--CSSPKDEG-----LC--SANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLD 236

  Fly    83 DCNR 86
            .|:|
Mouse   237 ACHR 240

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/32 (41%)
Tfpi2NP_001368837.1 Kunitz_TFPI2_1-like 68..124 CDD:438659