DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Spint2

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_035594.1 Gene:Spint2 / 20733 MGIID:1338031 Length:252 Species:Mus musculus


Alignment Length:87 Identity:27/87 - (31%)
Similarity:37/87 - (42%) Gaps:18/87 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQICQ---GRP----VFQLCTGGRDEGNRN---GRFCGLTAQNG-------MWFYNSRSRRCEKM 66
            ||:|:   ||.    |..|...|....:|.   ...||::...|       .|:||.....|:..
Mouse     2 AQLCELRRGRALLALVASLLLSGAQVASRELDVHESCGVSKVVGKCRASIPRWWYNITDGSCQPF 66

  Fly    67 NYRGCGGNGNRYCKVEDC-NRC 87
            .|.||.||||.|...|:| ::|
Mouse    67 VYGGCEGNGNNYQSKEECLDKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/33 (42%)
Spint2NP_035594.1 Kunitz_HAI2_1-like 36..88 CDD:438664 17/51 (33%)
Kunitz_HAI2_2-like 131..183 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.