DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and ZK287.4

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:54 Identity:20/54 - (37%)
Similarity:26/54 - (48%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            |:...|:|     |.|....| ||:|:..|..|....|.|.|||.||:...|:|
 Worm   257 CSLSPDKG-----FPGSVTVN-MWYYDPTSTTCSPFMYLGKGGNSNRFETSEEC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/32 (44%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636 20/54 (37%)
KU 318..368 CDD:197529
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636
Kunitz_conkunitzin 1054..1104 CDD:438636
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.