DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and ZC504.1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001362150.1 Gene:ZC504.1 / 191192 WormBaseID:WBGene00013916 Length:542 Species:Caenorhabditis elegans


Alignment Length:35 Identity:11/35 - (31%)
Similarity:19/35 - (54%) Gaps:1/35 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 MWFYNSRSRRCEKMNYRGC-GGNGNRYCKVEDCNR 86
            |::::|...:|:|.....| |.|.|::...|.|.|
 Worm    99 MFYFDSLDLKCKKFKVINCFGKNQNQFETYELCTR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 10/33 (30%)
ZC504.1NP_001362150.1 KU 79..135 CDD:197529 11/35 (31%)

Return to query results.
Submit another query.