DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:87 Identity:18/87 - (20%)
Similarity:35/87 - (40%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLIMACLTLYVASINAQICQGRPVFQLCTGGRDEGN---RNGRFCGLTAQNGMWFYNSRSRR 62
            :.||..:.|::..|:::..:          |....|.|.   :||:      :...:.::.:|..
 Worm     5 LTFLATILCVSELVSTLQPE----------CKLPLDMGKTPCKNGK------KEIRYHFDQKSNI 53

  Fly    63 CEKMNYRGCGGNGNRYCKVEDC 84
            .....|.|||||.|.:....:|
 Worm    54 PLAFEYSGCGGNKNNFKTESEC 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 9/32 (28%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 14/57 (25%)

Return to query results.
Submit another query.