DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and W05B2.2

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:80 Identity:26/80 - (32%)
Similarity:39/80 - (48%) Gaps:11/80 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LYVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGL-TAQNGMWFYNSRSRRCEKMNYRGCGGNG 75
            :|..:::| .|..|.:  .|    ::|.:.|..||| |.|.  |:|:....||.:..|:||.||.
 Worm   492 VYTGTMHA-CCPSREL--TC----NQGLQVGTTCGLSTLQR--WYYDPLHNRCNQFEYQGCNGND 547

  Fly    76 NRYCKVEDC-NRCRR 89
            |.:....|| ..|.|
 Worm   548 NNFVTRVDCIETCHR 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 12/33 (36%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636 20/57 (35%)
KU 613..665 CDD:197529
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.