DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and T21D12.12

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_499892.1 Gene:T21D12.12 / 188695 WormBaseID:WBGene00020651 Length:183 Species:Caenorhabditis elegans


Alignment Length:59 Identity:21/59 - (35%)
Similarity:29/59 - (49%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC-NRCR 88
            |...||.||..   ||.......:|:.: :|.|:...|:||.||.||:...|.| :.||
 Worm    23 CFSARDTGNSG---CGQQGARSFYFHKN-TRTCQPFFYQGCDGNSNRFQSKEACESACR 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 12/33 (36%)
T21D12.12NP_499892.1 Kunitz_BPTI 23..77 CDD:425421 19/57 (33%)
KU 127..182 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.