DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and K11D12.6

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:85 Identity:24/85 - (28%)
Similarity:37/85 - (43%) Gaps:14/85 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLIMACLTLYVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNY 68
            ::::....|:.||::..||.. ||        |.|...   |..|: :..:.|:...:||....|
 Worm     1 MILLLLPFLFGASVSQNICDS-PV--------DLGTAK---CSNTS-SIRYHYDPTVKRCLPFGY 52

  Fly    69 RGCGGNGNRYCKVEDC-NRC 87
            .|||||.|.:.....| .||
 Worm    53 TGCGGNENNFADPRICRQRC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 11/33 (33%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 19/66 (29%)

Return to query results.
Submit another query.