DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and piit-1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:54 Identity:19/54 - (35%)
Similarity:28/54 - (51%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            |...||.||.    |...:.:.|::|..|...|:...|:|||||.||:...::|
 Worm    24 CFAARDSGNT----CAENSSSRMFYYLPRLGTCQPFMYQGCGGNSNRFSSAQEC 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/32 (41%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421 19/54 (35%)
KU 137..192 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.