powered by:
Protein Alignment CG42538 and scl-14
DIOPT Version :9
Sequence 1: | NP_001163451.1 |
Gene: | CG42538 / 8673985 |
FlyBaseID: | FBgn0260646 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502532.1 |
Gene: | scl-14 / 184246 |
WormBaseID: | WBGene00008625 |
Length: | 208 |
Species: | Caenorhabditis elegans |
Alignment Length: | 45 |
Identity: | 14/45 - (31%) |
Similarity: | 20/45 - (44%) |
Gaps: | 9/45 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 CGLTAQNGMWFYNSRSRRCEKMNYRGCGG--NGNRYCKVEDCNRC 87
||:.. ||| |..:..| :|:..|. |.|.|.....|::|
Worm 157 CGMDT-NGM---NKVAVVC---HYQPQGNYLNQNIYTSGTTCSKC 194
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42538 | NP_001163451.1 |
KU |
<53..88 |
CDD:294074 |
10/37 (27%) |
scl-14 | NP_502532.1 |
SCP |
22..175 |
CDD:214553 |
8/24 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.