DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and C54D10.10

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:88 Identity:23/88 - (26%)
Similarity:42/88 - (47%) Gaps:20/88 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFL---LIMACLTLYVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRR 62
            |:|:   |::.|:: .|::||            |...:|.|..    |........::::.|:..
 Worm     1 MQFISIFLLLCCIS-SVSAIN------------CRQEKDTGVN----CDNKPITLKFYFDMRTNV 48

  Fly    63 CEKMNYRGCGGNGNRYCKVEDCN 85
            |:.:.|||||||.||:...:.|:
 Worm    49 CQPLFYRGCGGNENRFESRDACS 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 12/33 (36%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 16/55 (29%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.