DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and C02F12.5

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:59 Identity:17/59 - (28%)
Similarity:24/59 - (40%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            ||  ||........:.|..|.....:..|:|:|:...|....|.|||...|.:...|:|
 Worm    14 PV--LCQYACSSELKFGTACSENKTSTKWYYDSKLLFCYPYKYLGCGEGSNSFESNENC 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 11/32 (34%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 11/37 (30%)

Return to query results.
Submit another query.