DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and mlt-11

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:54 Identity:19/54 - (35%)
Similarity:26/54 - (48%) Gaps:7/54 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84
            |...||.||..|:|.       .||::...:.|:...|.||.||||.:...|:|
 Worm   737 CLHPRDSGNCRGQFV-------RWFFDDEKKNCDVFTYTGCQGNGNNFASKEEC 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 12/32 (38%)
mlt-11NP_001256938.1 TY <361..409 CDD:238114
Kunitz-type 429..473 CDD:438633
Kunitz_BPTI 538..590 CDD:425421
Kunitz-type 737..787 CDD:438633 19/54 (35%)
Kunitz_BPTI 803..855 CDD:425421
Kunitz_BPTI 865..917 CDD:425421
Kunitz-type 1083..1133 CDD:438633
Kunitz_BPTI 2176..2228 CDD:425421
Kunitz_ixolaris_2 2241..2291 CDD:438669
Kunitz_BPTI 2742..2793 CDD:425421
Lustrin_cystein 2910..2956 CDD:464222
Kunitz_BPTI 3070..3128 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.