DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Y43F8B.3

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001256874.1 Gene:Y43F8B.3 / 180277 WormBaseID:WBGene00012814 Length:1658 Species:Caenorhabditis elegans


Alignment Length:77 Identity:24/77 - (31%)
Similarity:30/77 - (38%) Gaps:20/77 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CTGGRDEG-----NRNGRFCGLTAQNG-------MWFYNSRSRRCEKMNYRGCGGNGNRYCKVED 83
            |..|.|:.     ...|..|.|..:.|       .|||||.:|:|:...|.|.|||.|.:...|.
 Worm   421 CHLGYDDATTVCCQSEGDPCSLVVKEGSGNHHLSRWFYNSNTRQCQPFTYTGQGGNENNFLLREH 485

  Fly    84 C--------NRC 87
            |        |.|
 Worm   486 CEATCPVWINAC 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 15/40 (38%)
Y43F8B.3NP_001256874.1 Kunitz-type 76..126 CDD:438633
Kunitz-type 131..181 CDD:438633
Kunitz_conkunitzin 232..282 CDD:438636
Lustrin_cystein 286..329 CDD:464222
Kunitz_conkunitzin 336..386 CDD:438636
Kunitz_conkunitzin 440..490 CDD:438636 18/49 (37%)
Lustrin_cystein 497..540 CDD:464222 1/1 (100%)
Kunitz_conkunitzin 546..596 CDD:438636
Kunitz_conkunitzin 651..702 CDD:438636
Kunitz_conkunitzin 754..804 CDD:438636
Lustrin_cystein 810..853 CDD:464222
Kunitz_conkunitzin 862..912 CDD:438636
Lustrin_cystein 918..962 CDD:464222
Kunitz_conkunitzin 973..1025 CDD:438636
Kunitz_conkunitzin 1077..1127 CDD:438636
Lustrin_cystein 1131..1176 CDD:464222
Kunitz_conkunitzin 1183..1233 CDD:438636
Lustrin_cystein 1244..1282 CDD:464222
Kunitz_conkunitzin 1288..1338 CDD:438636
Kunitz_conkunitzin 1396..1446 CDD:438636
Kunitz_conkunitzin 1499..1549 CDD:438636
Kunitz-type 1602..1652 CDD:438633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.