DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and F22E12.1

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:82 Identity:23/82 - (28%)
Similarity:36/82 - (43%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLIMACLTLYVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNY 68
            :|:..|     .::|:|.....|   .|....|.|.     |.|.. :..|:|:....||.:..|
 Worm     6 ILLFGC-----TAVNSQQLLSNP---KCNHWPDRGT-----CELDF-HVKWYYDRYDHRCRRFFY 56

  Fly    69 RGCGGNGNRYCKVEDCN 85
            .||.||.||:..:|:|:
 Worm    57 GGCEGNENRFDSLEECS 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/33 (39%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 18/55 (33%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.