DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and K10D3.4

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:69 Identity:22/69 - (31%)
Similarity:38/69 - (55%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC- 84
            :|..||.: :|...|::||     ||  ..:..|::|:::..||:..|.||.||.|.:...::| 
 Worm   402 VCCPRPQY-VCKLPREQGN-----CG--TYSNRWWFNAKTGNCEEFIYSGCQGNANNFETYKECQ 458

  Fly    85 NRCR 88
            :.||
 Worm   459 DYCR 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 11/33 (33%)
K10D3.4NP_492020.1 EB 46..100 CDD:460294
Kunitz_BPTI 170..226 CDD:425421
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:425421 17/58 (29%)
Kunitz_BPTI 518..571 CDD:425421
Kunitz_BPTI 628..681 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.