DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CRISP1

DIOPT Version :9

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:90 Identity:21/90 - (23%)
Similarity:29/90 - (32%) Gaps:20/90 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TLYVASINAQIC--QGRP----VFQLCTGGRDEGNRN-----GRFCGLTAQN-------GMWFYN 57
            |.|:.......|  ||.|    |...|..|.|...:|     |..|.....|       ....|.
Human   150 TSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYY 214

  Fly    58 SRSRRCE-KMNYRGCGGNGN-RYCK 80
            .....|: :::|.||..:.. .:||
Human   215 DEYFDCDIQVHYLGCNHSTTILFCK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 KU <53..88 CDD:294074 7/30 (23%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 7/26 (27%)
Crisp 195..249 CDD:285731 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.