DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and Ambp

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:52 Identity:19/52 - (36%)
Similarity:23/52 - (44%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGLTAQNG-------MWFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC-NRCR 88
            |.|....|       .::||..|..||...|.||.||||.:...:|| ..||
Mouse   230 CQLNYSEGPCLGMQERYYYNGASMACETFQYGGCLGNGNNFISEKDCLQTCR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/33 (42%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639 17/50 (34%)
Kunitz_bikunin_2-like 284..337 CDD:438640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.