DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and SPINT3

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:76 Identity:22/76 - (28%)
Similarity:31/76 - (40%) Gaps:14/76 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VFQLCTGGRDEGNRN------GRFCGLTAQNG-------MWFYNSRSRRCEKMNYRGCGGNGNRY 78
            :..||...|.|..|:      ...|....:.|       .||:|..:..||...|.|||||.|.:
Human    12 ILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNF 76

  Fly    79 CKVEDCNR-CR 88
            .:.|.|.: |:
Human    77 LRKEKCEKFCK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 14/32 (44%)
SPINT3NP_006643.1 Kunitz_BPTI 35..87 CDD:425421 16/51 (31%)

Return to query results.
Submit another query.