DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and SPINT2

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens


Alignment Length:35 Identity:14/35 - (40%)
Similarity:18/35 - (51%) Gaps:1/35 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC-NRC 87
            |:||.....|:...|.||.||.|.|...|:| .:|
Human    54 WWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/32 (41%)
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 13/33 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.