DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG42713

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster


Alignment Length:90 Identity:47/90 - (52%)
Similarity:54/90 - (60%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLIMACLTLYVASINAQICQGRPVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSRSRRCEK 65
            ||||||:|.:.||||..:||.|.|||..|.|..|:|||....|.|.......||:||.|..||.|
  Fly     1 MKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIK 65

  Fly    66 MNYRGCGGNGNRYCKVEDCNR-CRR 89
            |.|.||.||.||||.:.:|.| |.|
  Fly    66 MRYLGCKGNRNRYCTLNECQRKCVR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 19/32 (59%)
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 27/56 (48%)

Return to query results.
Submit another query.