DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and CG42716

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster


Alignment Length:90 Identity:39/90 - (43%)
Similarity:55/90 - (61%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLLIMACLTLYVASINAQI-CQGR-----PVFQLCTGGRDEGNRNGRFCGLTAQNGMWFYNSR 59
            |.||:|:|..||.:|..|:|: |:.|     |  :.|:|.|:.|...|..|.:.....:|:||.:
  Fly     1 MNFLIILAFFTLNMAFANSQLRCRARMNSGGP--RSCSGSRNIGTAFGLGCAMNFMPLVWYYNDK 63

  Fly    60 SRRCEKMNYRGCGGNGNRYCKVEDC 84
            |||||.|.|.|||||.||:|.::||
  Fly    64 SRRCETMPYLGCGGNSNRFCSLQDC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 20/32 (63%)
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 20/31 (65%)

Return to query results.
Submit another query.