powered by:
Protein Alignment CG42538 and crispld2
DIOPT Version :9
Sequence 1: | NP_001163451.1 |
Gene: | CG42538 / 8673985 |
FlyBaseID: | FBgn0260646 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003199065.1 |
Gene: | crispld2 / 100535149 |
ZFINID: | ZDB-GENE-130131-1 |
Length: | 508 |
Species: | Danio rerio |
Alignment Length: | 33 |
Identity: | 11/33 - (33%) |
Similarity: | 17/33 - (51%) |
Gaps: | 2/33 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 YNSRSRRCE-KMNYRGCGGNGNRY-CKVEDCNR 86
|.:::.:|| ||..:..|...||| |.....|:
Zfish 296 YLAQNIKCETKMRDKCKGATCNRYNCPANCLNK 328
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.