DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42538 and col28a1b

DIOPT Version :10

Sequence 1:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001289178.1 Gene:col28a1b / 100332225 ZFINID:ZDB-GENE-160503-1 Length:1109 Species:Danio rerio


Alignment Length:37 Identity:10/37 - (27%)
Similarity:20/37 - (54%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDCNR-CRR 89
            |:::.::..|.:..:.||.||.|::.....|.: |.|
Zfish  1072 WYFDPKANSCAQFWFGGCKGNKNQFDSELTCRKTCVR 1108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 8/31 (26%)
col28a1bNP_001289178.1 VWA 45..226 CDD:459670
gly_rich_SclB <243..>313 CDD:468478
gly_rich_SclB <291..>568 CDD:468478
gly_rich_SclB <491..>773 CDD:468478
vWFA 797..987 CDD:469594
Kunitz_collagen_alpha1_XXVIII 1056..1106 CDD:438671 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.