| Sequence 1: | NP_001163451.1 | Gene: | CG42538 / 8673985 | FlyBaseID: | FBgn0260646 | Length: | 89 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001153314.2 | Gene: | col28a2a / 100294690 | ZFINID: | ZDB-GENE-030131-4444 | Length: | 1208 | Species: | Danio rerio |
| Alignment Length: | 31 | Identity: | 13/31 - (41%) |
|---|---|---|---|
| Similarity: | 18/31 - (58%) | Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 54 WFYNSRSRRCEKMNYRGCGGNGNRYCKVEDC 84 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42538 | NP_001163451.1 | Kunitz-type | <53..86 | CDD:438633 | 13/31 (42%) |
| col28a2a | NP_001153314.2 | VWA | 61..242 | CDD:459670 | |
| gly_rich_SclB | <260..>560 | CDD:468478 | |||
| gly_rich_SclB | <511..>795 | CDD:468478 | |||
| VWA | 816..995 | CDD:459670 | |||
| Kunitz_collagen_alpha1_XXVIII | 1152..1202 | CDD:438671 | 13/31 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||