DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42397 and CG43896

DIOPT Version :10

Sequence 1:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster


Alignment Length:159 Identity:44/159 - (27%)
Similarity:69/159 - (43%) Gaps:28/159 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTTLPPPVLCADEDL----FLP-APDCREYYQCLY 76
            |.|:.::....:...||...:..|:|||       ||..|...|:    |:| ..:||:|:.|:.
  Fly   256 VPGTCTTESPCDDSTTTTTESCAEETTE-------PPASCDCGDIKNADFIPDEENCRKYFICID 313

  Fly    77 GEGILKICPDGLYWDRELNVCAWDSQH--CADDKNETTTPSTLNCASGLPFL-PYIPDCTKFIQC 138
            |..:...|..|..::..|:||..|:.:  |..|           |..|...: |  .||||:.:|
  Fly   314 GVLVAADCGKGNVFNANLSVCEVDADNTCCVAD-----------CTDGEAKVDP--QDCTKYFKC 365

  Fly   139 VYNIGFKLSCPSGLYWNQPLQSCDYTCDN 167
            .......:||.||.|:|:.|..|....:|
  Fly   366 QSGDWTSVSCDSGSYFNETLNCCQVDVNN 394

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42397NP_001163428.1 CBM_14 58..102 CDD:426342 14/48 (29%)
ChtBD2 125..163 CDD:214696 14/38 (37%)
CG43896NP_001261732.1 CBM_14 96..147 CDD:426342
CBM_14 153..206 CDD:426342