DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42397 and Mur2B

DIOPT Version :10

Sequence 1:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:133 Identity:36/133 - (27%)
Similarity:46/133 - (34%) Gaps:41/133 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PVLCADEDLFLPAPDCREYYQC--------LYGEGILKICPDGLYWDRELNVCAWDSQHCADDKN 109
            |..|..|..|....||:.||:|        |:.      ||.|..:......|....| |     
  Fly   146 PPQCQKEGRFPHPHDCKVYYRCDKNRTQPWLFA------CPAGTIFSPVERKCLPGDQ-C----- 198

  Fly   110 ETTTPSTLNCASGLPFLPYIP-DC-TKFIQCVYNIGFKLSCPSGLYWNQPLQSCDYTCDNAIEFS 172
                |||....||    .||| :| .||.:|.....|:......||         |||  .::.|
  Fly   199 ----PSTEISDSG----SYIPQNCELKFPECAEEGTFRSPTDCALY---------YTC--RLQES 244

  Fly   173 GAH 175
            |.:
  Fly   245 GTY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42397NP_001163428.1 CBM_14 58..102 CDD:426342 12/51 (24%)
ChtBD2 125..163 CDD:214696 10/39 (26%)
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342 12/52 (23%)
CBM_14 221..275 CDD:426342 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.