DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42397 and LOC1270270

DIOPT Version :10

Sequence 1:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_308952.4 Gene:LOC1270270 / 1270270 VectorBaseID:AGAMI1_009230 Length:201 Species:Anopheles gambiae


Alignment Length:140 Identity:40/140 - (28%)
Similarity:63/140 - (45%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DESTTVEDTTEVLVTTLPPPVLCADEDLFLPAPDCREYYQCLYGEGILKICPDGLYWDRELNVCA 98
            |:....:|..|      .||||.|.      ..||.::..|.:|..::..||.||.|:.....|.
Mosquito    66 DDRCPPQDDPE------QPPVLLAH------PTDCDKFLICNHGTTVVSKCPPGLLWNDSQKQCD 118

  Fly    99 WDSQ-HCADDKNETTTPS---TLNC-----ASGLPFLPYIPDCTKFIQC-VYNIGFKLSCPSGLY 153
            :.:| .||......|.|:   :.||     ...:.::|:..||.|:..| .|.:..:.:|||||:
Mosquito   119 YPAQAQCAPGVTPNTEPAPKPSPNCPPEYDPDHMVYIPHETDCGKYYICDPYGVELEQTCPSGLH 183

  Fly   154 WNQPLQSCDY 163
            ||..:..||:
Mosquito   184 WNPVVNYCDF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42397NP_001163428.1 CBM_14 58..102 CDD:426342 10/43 (23%)
ChtBD2 125..163 CDD:214696 14/38 (37%)
LOC1270270XP_308952.4 None

Return to query results.
Submit another query.