DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and Spink12

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_084337.2 Gene:Spink12 / 78242 MGIID:1925492 Length:87 Species:Mus musculus


Alignment Length:84 Identity:29/84 - (34%)
Similarity:36/84 - (42%) Gaps:19/84 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AMMALLGLLAIF-------------FVSSSEASYCP----CNLRKAEVCGTNGVTYQNRCVFECT 52
            |.:.|:.|..:|             |.|:.|.:..|    |......||||:|.||||||.| |.
Mouse     6 AFLLLISLACLFLSVDAVSQGGFQAFCSNYEKTLAPDGKSCPKTHKPVCGTDGKTYQNRCAF-CQ 69

  Fly    53 QREYRKLGRILNIKKMGSC 71
            ....|.||: |..|..|.|
Mouse    70 TAMERSLGK-LGFKHEGKC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 21/47 (45%)
Spink12NP_084337.2 KAZAL_PSTI 42..87 CDD:238648 20/46 (43%)

Return to query results.
Submit another query.