DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and SPINK2

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001258647.1 Gene:SPINK2 / 6691 HGNCID:11245 Length:134 Species:Homo sapiens


Alignment Length:46 Identity:15/46 - (32%)
Similarity:22/46 - (47%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CPCNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRILNIKKMGSC 71
            ||.:..  .|||::..||.|.|.. |  .:.|:.|..:.|.:.|.|
Human    94 CPRHFN--PVCGSDMSTYANECTL-C--MKIREGGHNIKIIRNGPC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 13/43 (30%)
SPINK2NP_001258647.1 Kazal_1 86..134 CDD:395004 14/44 (32%)

Return to query results.
Submit another query.