DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and CG34454

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001097457.1 Gene:CG34454 / 5740130 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster


Alignment Length:47 Identity:15/47 - (31%)
Similarity:21/47 - (44%) Gaps:4/47 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CPCNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRILNIKKMGSCQ 72
            ||...:...:||:|...|.|...|.|.    |..|..:.|.:.|||:
  Fly    83 CPTTSQYNPICGSNMQLYMNEEKFNCA----RFCGADIQIVRRGSCE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 12/43 (28%)
CG34454NP_001097457.1 KAZAL_FS 86..124 CDD:412159 11/41 (27%)

Return to query results.
Submit another query.