DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and Spink14

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001034307.2 Gene:Spink14 / 433178 MGIID:3646952 Length:96 Species:Mus musculus


Alignment Length:36 Identity:16/36 - (44%)
Similarity:20/36 - (55%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PCNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRI 62
            ||...|..:||||.|||.|.|:. |.: ..:..|||
Mouse    55 PCPDLKQPICGTNFVTYDNPCIL-CVE-SLKSGGRI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 16/36 (44%)
Spink14NP_001034307.2 KAZAL_FS 55..96 CDD:412159 16/36 (44%)

Return to query results.
Submit another query.